Rabbit FAM3C antibody
-
Catalog number70R-6730
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenFAM3C antibody was raised using the C terminal of FAM3C corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
-
SpecificityFAM3C antibody was raised against the C terminal of FAM3C
-
Cross ReactivityHuman,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM3C antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFAM3C
-
Short nameRabbit FAM3C antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FAM3C antibody raised against the C terminal of FAM3C
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetfamily with sequence similarity 3, member C, ILEI, FAM3C and IDBG-38333 and ENSG00000196937 and 10447, cytokine activity, Extracellular, Fam3c and IDBG-129573 and ENSMUSG00000029672 and 27999, FAM3C and IDBG-634725 and ENSBTAG00000007976 and 615690
-
Gene info
-
Identity
-
Gene
-
Long gene nameFAM3 metabolism regulating signaling molecule C
-
Synonyms gene name
- family with sequence similarity 3 member C
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-06-18
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data