Rabbit ERMAP antibody
-
Catalog number70R-7360
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERMAP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolERMAP
-
Short nameRabbit ERMAP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ERMAP antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targeterythroblast membrane-associated protein (Scianna blood group), ERMAP and IDBG-97277 and ENSG00000164010 and 114625, protein binding, Plasma membranes, Ermap and IDBG-182483 and ENSMUSG00000028644 and 27028
-
Gene info
-
Identity
-
Gene
-
Long gene nameerythroblast membrane associated protein (Scianna blood group)
-
Synonyms gene
-
Synonyms gene name
- Radin blood group
- Scianna blood group
- erythroblast membrane-associated protein
- erythroblast membrane-associated protein (RD and SC blood groups)
- erythroblast membrane-associated protein (Scianna blood group)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-09-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- V-set domain containing
- Butyrophilins
- Blood group antigens
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data