gentaur logogentaur logo
x

ERMAP antibody

  • Catalog number
    70R-7347
  • Product name
    ERMAP antibody
  • Size
    50 µg
  • Price
    Ask For Price
  • Contact us
    ERMAP antibody
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Cell Biology
  • Type of Immunogen
    ERMAP antibodies were raised using a synthetic peptide corresponding to a region with amino acids RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR
  • Raised in
    Rabbit
  • Cross Reactivity
    Human
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERMAP antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    ERMAP Blocking Peptide, catalog no. 33R-8176, is also available for use as a blocking control in assays to test for specificity of this ERMAP antibody
  • Additional Information
    This is a rabbit polyclonal antibody against ERMAP, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
    URL
  • More info
    More_info
  • Alternative to gene target
    • [ "erythroblast membrane-associated protein (Scianna blood group)", "ERMAP and IDBG-97277 and ENSG00000164010 and 114625", "protein binding", "Plasma membranes", "Ermap and IDBG-182483 and ENSMUSG00000028644 and 27028" ]
  • Gene target
    ERMAP
    • Gene info
    Locus Specific Databases:Blood Group Antigen Mutation DatabaseLRG_806
  • Gene symbol
    ERMAP
  • Short name
    ERMAP antibody
  • technique filter
    • Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative technique
    antibodies