Rabbit ECT2 antibody
-
Catalog number70R-5714
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
-
SpecificityECT2 antibody was raised against the middle region of ECT2
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ECT2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolECT2
-
Short nameRabbit ECT2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ECT2 antibody raised against the middle region of ECT2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetepithelial cell transforming sequence 2 oncogene, ARHGEF31, ECT2 and IDBG-65239 and ENSG00000114346 and 1894, protein homodimerization activity, nuclei, Ect2 and IDBG-134125 and ENSMUSG00000027699 and 13605, BT.28366 and IDBG-636155 and ENSBTAG00000023814 and 100849477,504746
-
Gene info
-
Identity
-
Gene
-
Long gene nameepithelial cell transforming 2
-
Synonyms gene name
- epithelial cell transforming sequence 2 oncogene
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-10-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Dbl family Rho GEFs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data