Rabbit DSCAM antibody

  • Catalog number
    70R-6114
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Neuroscience
  • Immunogen
    DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV
  • Specificity
    DSCAM antibody was raised against the middle region of DSCAM
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DSCAM antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    DSCAM  
  • Gene symbol
    DSCAM-IT1, DSCAM-AS1, DSCAM
  • Short name
    Rabbit DSCAM antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal DSCAM antibody raised against the middle region of DSCAM
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    Down syndrome cell adhesion molecule, CHD2 and CHD2-42 and CHD2-52, DSCAM and IDBG-3815 and ENSG00000171587 and 1826, protein binding, Extracellular, Dscam and IDBG-180173 and ENSMUSG00000050272 and 13508, DSCAM and IDBG-639205 and ENSBTAG00000004754 and 100337016,101908463
Gene info
  • Identity
  • Gene
  • Long gene name
    DSCAM intronic transcript 1
  • Synonyms gene name
    • DSCAM intronic transcript 1 (non-protein coding)
  • Locus
  • Discovery year
    2011-05-20
  • Classification
    • Intronic transcripts
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    DS cell adhesion molecule
  • Synonyms gene name
    • Down syndrome cell adhesion molecule
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-06-10
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Ig-like cell adhesion molecule family
    • I-set domain containing
    • Fibronectin type III domain containing
    • MicroRNA protein coding host genes
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee