Rabbit DHCR24 antibody
-
Catalog number70R-6954
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenDHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
-
SpecificityDHCR24 antibody was raised against the middle region of DHCR24
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHCR24 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDHCR24-DT, DHCR24
-
Short nameRabbit DHCR24 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DHCR24 antibody raised against the middle region of DHCR24
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene target24-dehydrocholesterol reductase, DCE and Nbla03646 and seladin-1 and SELADIN1, DHCR24 and IDBG-99054 and ENSG00000116133 and 1718, oxidoreductase activity, nuclei, Dhcr24 and IDBG-170296 and ENSMUSG00000034926 and 74754, DHCR24 and IDBG-639033 and ENSBTAG00000004688 and 533726
-
Gene info
-
Identity
-
Gene
-
Long gene nameDHCR24 divergent transcript
-
Locus
-
Discovery year2018-07-13
-
Entrez gene record
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene name24-dehydrocholesterol reductase
-
Synonyms gene
-
Synonyms gene name
- desmosterol-to-cholesterol enzyme
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-04-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data