Rabbit DHCR24 antibody

  • Catalog number
    70R-6265
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Proteases, Inhibitors, & Enzymes
  • Immunogen
    DHCR24 antibody was raised using the N terminal of DHCR24 corresponding to a region with amino acids FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
  • Specificity
    DHCR24 antibody was raised against the N terminal of DHCR24
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DHCR24 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    DHCR24  
  • Gene symbol
    DHCR24-DT, DHCR24
  • Short name
    Rabbit DHCR24 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal DHCR24 antibody raised against the N terminal of DHCR24
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    24-dehydrocholesterol reductase, DCE and Nbla03646 and seladin-1 and SELADIN1, DHCR24 and IDBG-99054 and ENSG00000116133 and 1718, oxidoreductase activity, nuclei, Dhcr24 and IDBG-170296 and ENSMUSG00000034926 and 74754, DHCR24 and IDBG-639033 and ENSBTAG00000004688 and 533726
Gene info
  • Identity
  • Gene
  • Long gene name
    DHCR24 divergent transcript
  • Locus
  • Discovery year
    2018-07-13
  • Entrez gene record
  • Classification
    • Divergent transcripts
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee