Rabbit CHRNA7 antibody
-
Catalog number70R-1540
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenCHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
-
SpecificityCHRNA7 antibody was raised against the middle region of CHRNA7
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHRNA7 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCHRNA7, CHRFAM7A
-
Short nameRabbit CHRNA7 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CHRNA7 antibody raised against the middle region of CHRNA7
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcholinergic receptor, nicotinic, alpha 7 (neuronal), CHRNA7-2 and NACHRA7, CHRNA7 and IDBG-5070 and ENSG00000175344 and 1139,89832, protein homodimerization activity, Cell surfaces, Chrna7 and IDBG-190675 and ENSMUSG00000030525 and 11441, CHRNA7 and IDBG-630821 and ENSBTAG00000015775 and 282178
-
Gene info
-
Identity
-
Gene
-
Long gene namecholinergic receptor nicotinic alpha 7 subunit
-
Synonyms gene name
- cholinergic receptor, nicotinic, alpha polypeptide 7
- cholinergic receptor, nicotinic, alpha 7 (neuronal)
- cholinergic receptor, nicotinic alpha 7
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1993-05-25
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Cholinergic receptors nicotinic subunits
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameCHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion
-
Synonyms gene name
- CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-06-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data