- Catalog number70R-1540
- Product nameCHRNA7 antibody
- Size100 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchNeuroscience
- Type of ImmunogenCHRNA7 antibodies were raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
- Raised inRabbit
- SpecificityCHRNA7 antibody was raised against the middle region of CHRNA7
- Cross ReactivityHuman
- Method of PurificationTotal IgG Protein A purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHRNA7 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1.25 ug/ml
- Assay InformationCHRNA7 Blocking Peptide, catalog no. 33R-9739, is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody
- Additional InformationThis is a rabbit polyclonal antibody against CHRNA7, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Alternative to gene target
- [ "cholinergic receptor, nicotinic, alpha 7 (neuronal)", "CHRNA7-2 and NACHRA7", "CHRNA7 and IDBG-5070 and ENSG00000175344 and 1139,89832", "protein homodimerization activity", "Cell surfaces", "Chrna7 and IDBG-190675 and ENSMUSG00000030525 and 11441", "CHRNA7 and IDBG-630821 and ENSBTAG00000015775 and 282178" ]
- Gene targetCHRNA7
- Identity:HGNC:1960
- Gene:CHRNA7
- Long gene name:cholinergic receptor nicotinic alpha 7 subunit
- Synonyms gene name:cholinergic receptor, nicotinic, alpha polypeptide 7, cholinergic receptor, nicotinic, alpha 7 (neuronal), cholinergic receptor, nicotinic alpha 7
- Discovery year:1993-05-25
- Entrez gene record:1139
- Pubmed identification:8188270
- Classification:Cholinergic receptors nicotinic subunits
- VEGA ID:OTTHUMG00000129285
- Identity:HGNC:15781
- Gene:CHRFAM7A
- Long gene name:CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion
- Synonyms gene name:CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion
- Synonyms:D-10CHRNA7-DR1
- Discovery year:2001-06-29
- Entrez gene record:89832
- Pubmed identification:11829490
- RefSeq identity:NM_148911
- VEGA ID:OTTHUMG00000175645
- Gene symbolCHRNA7, CHRFAM7A
- Short nameCHRNA7 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies