Rabbit CD36 antibody
-
Catalog number70R-6098
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenCD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD36 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCD36
-
Short nameRabbit CD36 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CD36 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetCD36 molecule (thrombospondin receptor), BDPLT10 and CHDS7 and FAT and GP3B and GP4 and GPIV and PASIV and SCARB3, CD36 and IDBG-24023 and ENSG00000135218 and 948, lipoprotein particle binding, Extracellular, Cd36 and IDBG-136838 and ENSMUSG00000002944 and 12491
-
Gene info
-
Identity
-
Gene
-
Long gene nameCD36 molecule
-
Synonyms gene name
- CD36 antigen (collagen type I receptor, thrombospondin receptor)
- CD36 molecule (thrombospondin receptor)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-06-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- Scavenger receptors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data