CD36 antibody

• Catalog number
  70R-6104
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Immunology
• Type of Immunogen
  CD36 antibodies were raised using a synthetic peptide corresponding to a region with amino acids MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
• Raised in
  Rabbit
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD36 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• Usage Recommendations
  WB: 0.2-1 ug/ml; IHC: 1 ug/ml
• Assay Information
  CD36 Blocking Peptide, catalog no. 33R-6013, is also available for use as a blocking control in assays to test for specificity of this CD36 antibody
• Additional Information
  This is a rabbit polyclonal antibody against CD36. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  CD36  
• Gene symbol
  CD36
• Short name
  CD36 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal CD36 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  CD36 molecule (thrombospondin receptor), BDPLT10 and CHDS7 and FAT and GP3B and GP4 and GPIV and PASIV and SCARB3, CD36 and IDBG-24023 and ENSG00000135218 and 948, lipoprotein particle binding, Extracellular, Cd36 and IDBG-136838 and ENSMUSG00000002944 and 12491

Gene info

• Identity
  HGNC:1663
• Gene
  CD36
• Long gene name
  CD36 molecule
• Synonyms gene name
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)
  • CD36 molecule (thrombospondin receptor)
• Synonyms
  • SCARB3
  • GPIV
  • FAT
  • GP4
  • GP3B
• GenBank acession
  • Z32770
• Locus
  7q21.11
• Discovery year
  1993-06-04
• Entrez gene record
  948
• Pubmed identfication
  • 7503937
• RefSeq identity
  • NM_001001547
• Classification
  • CD molecules
  • Scavenger receptors
• VEGA ID
  OTTHUMG00000155383

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products