Rabbit CAV1 antibody

• Catalog number
  70R-2555
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Neuroscience
• Immunogen
  CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
• Specificity
  CAV1 antibody was raised against the N terminal of CAV1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAV1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  CAV1  
• Gene symbol
  CAV1
• Short name
  Rabbit CAV1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal CAV1 antibody raised against the N terminal of CAV1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  caveolin 1, caveolae protein, 22kDa, BSCL3 and CGL3 and LCCNS and MSTP085 and PPH3 and VIP21, CAV1 and IDBG-37314 and ENSG00000105974 and 857, nitric-oxide synthase binding, Cell surfaces, Cav1 and IDBG-129000 and ENSMUSG00000007655 and 12389, CAV1 and IDBG-632834 and ENSBTAG00000017869 and 281040

Gene info

• Identity
  HGNC:1527
• Gene
  CAV1
• Long gene name
  caveolin 1
• Synonyms gene
  • CAV
• Synonyms gene name
  • caveolin 1, caveolae protein, 22kD
  • caveolin 1, caveolae protein, 22kDa
• GenBank acession
  • AF125348
• Locus
  7q31.2
• Discovery year
  1993-11-02
• Entrez gene record
  857
• Pubmed identfication
  • 10087206
• RefSeq identity
  • NM_001753
• Classification
  • Caveolins
• VEGA ID
  OTTHUMG00000023413

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products