Rabbit CAV1 antibody
-
Catalog number70R-2555
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenCAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
-
SpecificityCAV1 antibody was raised against the N terminal of CAV1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAV1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCAV1
-
Short nameRabbit CAV1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CAV1 antibody raised against the N terminal of CAV1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcaveolin 1, caveolae protein, 22kDa, BSCL3 and CGL3 and LCCNS and MSTP085 and PPH3 and VIP21, CAV1 and IDBG-37314 and ENSG00000105974 and 857, nitric-oxide synthase binding, Cell surfaces, Cav1 and IDBG-129000 and ENSMUSG00000007655 and 12389, CAV1 and IDBG-632834 and ENSBTAG00000017869 and 281040
-
Gene info
-
Identity
-
Gene
-
Long gene namecaveolin 1
-
Synonyms gene
-
Synonyms gene name
- caveolin 1, caveolae protein, 22kD
- caveolin 1, caveolae protein, 22kDa
-
GenBank acession
-
Locus
-
Discovery year1993-11-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Caveolins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data