CAV1 antibody

• Catalog number
  70R-2555
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Neuroscience
• Type of Immunogen
  CAV1 antibodies were raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL
• Raised in
  Rabbit
• Specificity
  CAV1 antibody was raised against the N terminal of CAV1
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAV1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  CAV1 Blocking Peptide, catalog no. 33R-8458, is also available for use as a blocking control in assays to test for specificity of this CAV1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against CAV1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  CAV1  
• Gene symbol
  CAV1
• Short name
  CAV1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal CAV1 antibody raised against the N terminal of CAV1
• Alternative technique
  antibodies
• Alternative to gene target
  caveolin 1, caveolae protein, 22kDa, BSCL3 and CGL3 and LCCNS and MSTP085 and PPH3 and VIP21, CAV1 and IDBG-37314 and ENSG00000105974 and 857, nitric-oxide synthase binding, Cell surfaces, Cav1 and IDBG-129000 and ENSMUSG00000007655 and 12389, CAV1 and IDBG-632834 and ENSBTAG00000017869 and 281040

Gene info

• Identity
  HGNC:1527
• Gene
  CAV1
• Long gene name
  caveolin 1
• Synonyms gene
  • CAV
• Synonyms gene name
  • caveolin 1, caveolae protein, 22kD
  • caveolin 1, caveolae protein, 22kDa
• GenBank acession
  • AF125348
• Locus
  7q31.2
• Discovery year
  1993-11-02
• Entrez gene record
  857
• Pubmed identfication
  • 10087206
• RefSeq identity
  • NM_001753
• Classification
  • Caveolins
• VEGA ID
  OTTHUMG00000023413

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products