Rabbit ATP5B antibody
-
Catalog number70R-1100
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
-
SpecificityATP5B antibody was raised against the C terminal of ATP5B
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ATP5B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolATP5F1B
-
Short nameRabbit ATP5B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ATP5B antibody raised against the C terminal of ATP5B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, ATPMB and ATPSB and HEL-S-271, ATP5B and IDBG-41395 and ENSG00000110955 and 506, hydrolase activity, nuclei, Atp5b and IDBG-196497 and ENSMUSG00000025393 and 11947, ATP5B and IDBG-635890 and ENSBTAG00000013315 and 327675
-
Gene info
-
Identity
-
Gene
-
Long gene nameATP synthase F1 subunit beta
-
Synonyms gene
-
Synonyms gene name
- ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
-
GenBank acession
-
Locus
-
Discovery year1989-06-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Small nucleolar RNA protein coding host genes
- ATPase F1/V1 alpha/A and beta/B subunit family
- Mitochondrial complex V: ATP synthase subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data