Rabbit ATP5B antibody

  • Catalog number
    70R-1100
  • Price
    Please ask
  • Size
    100 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Proteases, Inhibitors, & Enzymes
  • Immunogen
    ATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
  • Specificity
    ATP5B antibody was raised against the C terminal of ATP5B
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ATP5B antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    ATP5B  
  • Gene symbol
    ATP5F1B
  • Short name
    Rabbit ATP5B antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal ATP5B antibody raised against the C terminal of ATP5B
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, ATPMB and ATPSB and HEL-S-271, ATP5B and IDBG-41395 and ENSG00000110955 and 506, hydrolase activity, nuclei, Atp5b and IDBG-196497 and ENSMUSG00000025393 and 11947, ATP5B and IDBG-635890 and ENSBTAG00000013315 and 327675
Gene info
  • Identity
  • Gene
  • Long gene name
    ATP synthase F1 subunit beta
  • Synonyms gene
  • Synonyms gene name
    • ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
  • GenBank acession
  • Locus
  • Discovery year
    1989-06-30
  • Entrez gene record
    506
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small nucleolar RNA protein coding host genes
    • ATPase F1/V1 alpha/A and beta/B subunit family
    • Mitochondrial complex V: ATP synthase subunits
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee