Rabbit ALOX15B antibody
-
Catalog number70R-2884
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
-
SpecificityALOX15B antibody was raised against the N terminal of ALOX15B
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALOX15B antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolALOX15B
-
Short nameRabbit ALOX15B antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ALOX15B antibody raised against the N terminal of ALOX15B
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetarachidonate 15-lipoxygenase, type B, 15-LOX-2, ALOX15B and IDBG-27642 and ENSG00000179593 and 247, oxidoreductase activity, nuclei, Alox8 and IDBG-190116 and ENSMUSG00000020891 and 11688, ALOX15B and IDBG-635491 and ENSBTAG00000008779 and 286820
-
Gene info
-
Identity
-
Gene
-
Long gene namearachidonate 15-lipoxygenase type B
-
Synonyms gene name
- arachidonate 15-lipoxygenase, second type
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-07-22
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Arachidonate lipoxygenases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
-
Tree numbers
- E05.393.220
-
Qualifiersdrug effects, methods, radiation effects