Rabbit ALOX15B antibody

• Catalog number
  70R-1635
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR
• Specificity
  ALOX15B antibody was raised against the C terminal of ALOX15B
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALOX15B antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ALOX15B  
• Gene symbol
  ALOX15B
• Short name
  Rabbit ALOX15B antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ALOX15B antibody raised against the C terminal of ALOX15B
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  arachidonate 15-lipoxygenase, type B, 15-LOX-2, ALOX15B and IDBG-27642 and ENSG00000179593 and 247, oxidoreductase activity, nuclei, Alox8 and IDBG-190116 and ENSMUSG00000020891 and 11688, ALOX15B and IDBG-635491 and ENSBTAG00000008779 and 286820

Gene info

• Identity
  HGNC:434
• Gene
  ALOX15B
• Long gene name
  arachidonate 15-lipoxygenase type B
• Synonyms gene name
  • arachidonate 15-lipoxygenase, second type
• Synonyms
  • 15-LOX-2
• GenBank acession
  • U78294
• Locus
  17p13.1
• Discovery year
  1998-07-22
• Entrez gene record
  247
• Pubmed identfication
  • 9177185
• Classification
  • Arachidonate lipoxygenases
• VEGA ID
  OTTHUMG00000108181

MeSH Data

• Name
  Cloning, Molecular
• Concept
  Scope note: The insertion of recombinant DNA molecules from prokaryotic and/or eukaryotic sources into a replicating vehicle, such as a plasmid or virus vector, and the introduction of the resultant hybrid molecules into recipient cells without altering the viability of those cells.
• Tree numbers
  • E05.393.220
• Qualifiers
  drug effects, methods, radiation effects

Similar products