Rabbit ALDOC antibody
-
Catalog number70R-2334
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
-
SpecificityALDOC antibody was raised against the N terminal of ALDOC
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDOC antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolALDOC
-
Short nameRabbit ALDOC antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ALDOC antibody raised against the N terminal of ALDOC
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetaldolase C, fructose-bisphosphate, ALDC, ALDOC and IDBG-36924 and ENSG00000109107 and 230, cytoskeletal protein binding, Cytoplasm, Aldoc and IDBG-202678 and ENSMUSG00000017390 and 11676, ALDOC and IDBG-631697 and ENSBTAG00000013099 and 504584
-
Gene info
-
Identity
-
Gene
-
Long gene namealdolase, fructose-bisphosphate C
-
Synonyms gene name
- aldolase C, fructose-bisphosphate
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
Classification
- Aldolases
- Endoribonucleases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data