Rabbit ALDOC antibody

  • Catalog number
    70R-2334
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Proteases, Inhibitors, & Enzymes
  • Immunogen
    ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
  • Specificity
    ALDOC antibody was raised against the N terminal of ALDOC
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDOC antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    ALDOC  
  • Gene symbol
    ALDOC
  • Short name
    Rabbit ALDOC antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal ALDOC antibody raised against the N terminal of ALDOC
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    aldolase C, fructose-bisphosphate, ALDC, ALDOC and IDBG-36924 and ENSG00000109107 and 230, cytoskeletal protein binding, Cytoplasm, Aldoc and IDBG-202678 and ENSMUSG00000017390 and 11676, ALDOC and IDBG-631697 and ENSBTAG00000013099 and 504584
Gene info
  • Identity
  • Gene
  • Long gene name
    aldolase, fructose-bisphosphate C
  • Synonyms gene name
    • aldolase C, fructose-bisphosphate
  • GenBank acession
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
    230
  • Classification
    • Aldolases
    • Endoribonucleases
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee