Rabbit ALDOC antibody

• Catalog number
  70R-2603
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
• Specificity
  ALDOC antibody was raised against the C terminal of ALDOC
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDOC antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ALDOC  
• Gene symbol
  ALDOC
• Short name
  Rabbit ALDOC antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ALDOC antibody raised against the C terminal of ALDOC
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  aldolase C, fructose-bisphosphate, ALDC, ALDOC and IDBG-36924 and ENSG00000109107 and 230, cytoskeletal protein binding, Cytoplasm, Aldoc and IDBG-202678 and ENSMUSG00000017390 and 11676, ALDOC and IDBG-631697 and ENSBTAG00000013099 and 504584

Gene info

• Identity
  HGNC:418
• Gene
  ALDOC
• Long gene name
  aldolase, fructose-bisphosphate C
• Synonyms gene name
  • aldolase C, fructose-bisphosphate
• GenBank acession
  • AF054987
• Locus
  17q11.2
• Discovery year
  1986-01-01
• Entrez gene record
  230
• Classification
  • Aldolases
  • Endoribonucleases
• VEGA ID
  OTTHUMG00000132605

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products