Rabbit ABCD4 antibody

#
  • Catalog number
    70R-1784
  • Price:

    Please ask

    Ask for price
  • Size
    100 ug
# #
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Cell Biology
  • Immunogen
    ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
  • Specificity
    NA
  • Cross Reactivity
    Human,Mouse,Rat,Dog
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABCD4 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
#
  • Gene target
    ABCD4  
  • Gene symbol
    ABCD4
  • Short name
    Rabbit ABCD4 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal ABCD4 antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    ATP-binding cassette, sub-family D (ALD), member 4, ABC41 and EST352188 and MAHCJ and P70R and P79R and PMP69 and PXMP1L, ABCD4 and IDBG-11957 and ENSG00000119688 and 5826, ATPase activity, Plasma membranes, Abcd4 and IDBG-156897 and ENSMUSG00000021240 and 19300, ABCD4 and IDBG-646851 and ENSBTAG00000014633 and 528646
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The number of CD4-POSITIVE T-LYMPHOCYTES per unit volume of BLOOD. Determination requires the use of a fluorescence-activated flow cytometer.
  • Tree numbers
    • E01.370.225.500.195.107.595.500.150
    • E01.370.225.625.107.595.500.150
    • E05.200.500.195.107.595.500.150
    • E05.200.625.107.595.500.150
    • E05.242.195.107.595.500.150
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee