Rabbit ABCD4 antibody
#
-
Catalog number70R-1784
-
Price:
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABCD4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolABCD4
-
Short nameRabbit ABCD4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ABCD4 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetATP-binding cassette, sub-family D (ALD), member 4, ABC41 and EST352188 and MAHCJ and P70R and P79R and PMP69 and PXMP1L, ABCD4 and IDBG-11957 and ENSG00000119688 and 5826, ATPase activity, Plasma membranes, Abcd4 and IDBG-156897 and ENSMUSG00000021240 and 19300, ABCD4 and IDBG-646851 and ENSBTAG00000014633 and 528646
-
Gene info
-
Identity
-
Gene
-
Long gene nameATP binding cassette subfamily D member 4
-
Synonyms gene
-
Synonyms gene name
- ATP-binding cassette, sub-family D (ALD), member 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-10-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATP binding cassette subfamily D
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: The number of CD4-POSITIVE T-LYMPHOCYTES per unit volume of BLOOD. Determination requires the use of a fluorescence-activated flow cytometer.
-
Tree numbers
- E01.370.225.500.195.107.595.500.150
- E01.370.225.625.107.595.500.150
- E05.200.500.195.107.595.500.150
- E05.200.625.107.595.500.150
- E05.242.195.107.595.500.150
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data