ABCD4 antibody

• Catalog number
  70R-1784
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  ABCD4 antibodies were raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA
• Raised in
  Rabbit
• Cross Reactivity
  Human,Mouse,Rat,Dog
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABCD4 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1.25 ug/ml
• Assay Information
  ABCD4 Blocking Peptide, catalog no. 33R-2911, is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody
• Additional Information
  This is a rabbit polyclonal antibody against ABCD4, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ABCD4  
• Gene symbol
  ABCD4
• Short name
  ABCD4 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ABCD4 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  ATP-binding cassette, sub-family D (ALD), member 4, ABC41 and EST352188 and MAHCJ and P70R and P79R and PMP69 and PXMP1L, ABCD4 and IDBG-11957 and ENSG00000119688 and 5826, ATPase activity, Plasma membranes, Abcd4 and IDBG-156897 and ENSMUSG00000021240 and 19300, ABCD4 and IDBG-646851 and ENSBTAG00000014633 and 528646

Gene info

• Identity
  HGNC:68
• Gene
  ABCD4
• Long gene name
  ATP binding cassette subfamily D member 4
• Synonyms gene
  • PXMP1L
• Synonyms gene name
  • ATP-binding cassette, sub-family D (ALD), member 4
• Synonyms
  • PMP69
  • P70R
  • EST352188
• GenBank acession
  • AF009746
• Locus
  14q24.3
• Discovery year
  1997-10-27
• Entrez gene record
  5826
• Pubmed identfication
  • 9266848
  • 9302272
• RefSeq identity
  • NM_005050
• Classification
  • ATP binding cassette subfamily D
• VEGA ID
  OTTHUMG00000171207

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products