PTGS1 Blocking Peptide

• Catalog number
  33R-3265
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Proteases, Inhibitors, & Enzymes
• Tag Conjugate
  GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PTGS1  
• Gene symbol
  PTGS1
• Short name
  PTGS1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase), COX1 and COX3 and PCOX1 and PES-1 and PGG/HS and PGHS-1 and PGHS1 and PHS1 and PTGHS, PTGS1 and IDBG-83887 and ENSG00000095303 and 5742, dioxygenase activity, nuclei, Ptgs1 and IDBG-165198 and ENSMUSG00000047250 and 19224, PTGS1 and IDBG-638565 and ENSBTAG00000006716 and 282022

Gene info

• Identity
  HGNC:9604
• Gene
  PTGS1
• Long gene name
  prostaglandin-endoperoxide synthase 1
• Synonyms gene name
  • prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
• Synonyms
  • COX1
  • PGHS-1
  • PTGHS
• Synonyms name
  • cyclooxygenase-1
• GenBank acession
  • M59979
• Locus
  9q33.2
• Discovery year
  1992-10-27
• Entrez gene record
  5742
• Pubmed identfication
  • 2512924
  • 1907252
• VEGA ID
  OTTHUMG00000020605
• Locus Specific Databases
  • LRG_639

Similar products