Rabbit PTGS1 antibody

• Catalog number
  70R-7317
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE
• Specificity
  PTGS1 antibody was raised against the middle region of PTGS1
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTGS1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PTGS1  
• Gene symbol
  PTGS1
• Short name
  Rabbit PTGS1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PTGS1 antibody raised against the middle region of PTGS1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase), COX1 and COX3 and PCOX1 and PES-1 and PGG/HS and PGHS-1 and PGHS1 and PHS1 and PTGHS, PTGS1 and IDBG-83887 and ENSG00000095303 and 5742, dioxygenase activity, nuclei, Ptgs1 and IDBG-165198 and ENSMUSG00000047250 and 19224, PTGS1 and IDBG-638565 and ENSBTAG00000006716 and 282022

Gene info

• Identity
  HGNC:9604
• Gene
  PTGS1
• Long gene name
  prostaglandin-endoperoxide synthase 1
• Synonyms gene name
  • prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
• Synonyms
  • COX1
  • PGHS-1
  • PTGHS
• Synonyms name
  • cyclooxygenase-1
• GenBank acession
  • M59979
• Locus
  9q33.2
• Discovery year
  1992-10-27
• Entrez gene record
  5742
• Pubmed identfication
  • 2512924
  • 1907252
• VEGA ID
  OTTHUMG00000020605
• Locus Specific Databases
  • LRG_639

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products