PSMB2 Blocking Peptide

• Catalog number
  33R-10064
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Protein Modification & Stress Response
• Residues
  YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERA
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  PSMB2  
• Gene symbol
  PSMB2
• Short name
  PSMB2 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB2 antibody, catalog no. 70R-2346
• Alternative technique
  control, peptides
• Alternative to gene target
  proteasome (prosome, macropain) subunit, beta type, 2, HC7-I, PSMB2 and IDBG-96209 and ENSG00000126067 and 5690, protein binding, nuclei, Psmb2 and IDBG-189115 and ENSMUSG00000028837 and 26445, PSMB2 and IDBG-641505 and ENSBTAG00000002377 and 516919

Gene info

• Identity
  HGNC:9539
• Gene
  PSMB2
• Long gene name
  proteasome 20S subunit beta 2
• Synonyms gene name
  • proteasome (prosome, macropain) subunit, beta type, 2
  • proteasome subunit beta 2
• Synonyms
  • HC7-I
• Synonyms name
  • proteasome subunit β4
• GenBank acession
  • D26599
• Locus
  1p34.3
• Discovery year
  1995-05-03
• Entrez gene record
  5690
• Pubmed identfication
  • 7918633
• RefSeq identity
  • NM_002794
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000004169

Similar products