Rabbit PSMB2 antibody

• Catalog number
  70R-2347
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Protein Modification & Stress Response
• Immunogen
  PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD
• Specificity
  NA
• Cross Reactivity
  Human, Mouse, Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMB2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PSMB2  
• Gene symbol
  PSMB2
• Short name
  Rabbit PSMB2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PSMB2 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  proteasome (prosome, macropain) subunit, beta type, 2, HC7-I, PSMB2 and IDBG-96209 and ENSG00000126067 and 5690, protein binding, nuclei, Psmb2 and IDBG-189115 and ENSMUSG00000028837 and 26445, PSMB2 and IDBG-641505 and ENSBTAG00000002377 and 516919

Gene info

• Identity
  HGNC:9539
• Gene
  PSMB2
• Long gene name
  proteasome 20S subunit beta 2
• Synonyms gene name
  • proteasome (prosome, macropain) subunit, beta type, 2
  • proteasome subunit beta 2
• Synonyms
  • HC7-I
• Synonyms name
  • proteasome subunit β4
• GenBank acession
  • D26599
• Locus
  1p34.3
• Discovery year
  1995-05-03
• Entrez gene record
  5690
• Pubmed identfication
  • 7918633
• RefSeq identity
  • NM_002794
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000004169

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products