PIWIL2 antibody
-
Catalog number70R-2277
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchDifferentiation & Development
-
Type of ImmunogenPIWIL2 antibodies were raised using a synthetic peptide corresponding to a region with amino acids QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM
-
Raised inRabbit
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIWIL2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationPIWIL2 Blocking Peptide, catalog no. 33R-7778, is also available for use as a blocking control in assays to test for specificity of this PIWIL2 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against PIWIL2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolPIWIL2-DT, PIWIL2
-
Short namePIWIL2 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal PIWIL2 antibody
-
Alternative techniqueantibodies
-
Alternative to gene targetpiwi-like 2 (Drosophila), PIWIL2 and IDBG-10698 and ENSG00000197181 and 55124, piRNA binding, Cytoplasm, Piwil2 and IDBG-178442 and ENSMUSG00000033644 and 57746, PIWIL2 and IDBG-634785 and ENSBTAG00000015835 and 537068
-
Gene info
-
Identity
-
Gene
-
Long gene namePIWIL2 divergent transcript
-
Locus
-
Discovery year2021-03-18
-
Entrez gene record
-
RefSeq identity
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene namepiwi like RNA-mediated gene silencing 2
-
Synonyms gene name
- piwi-like 2 (Drosophila)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-04-26
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Piwi like RNA-mediated gene silencing family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data