Glucagon antibody

  • Catalog number
    70R-6207
  • Price
    Please ask
  • Size
    50 µg
  • Category
    Primary Antibody
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Area of research
    Nutrition & Metabolism
  • Type of Immunogen
    Glucagon antibodies were raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN
  • Raised in
    Rabbit
  • Specificity
    Glucagon antibody was raised against the middle region of GCG
  • Cross Reactivity
    Human,Mouse,Rat
  • Method of Purification
    Affinity purified
  • Concentration
    1 mg/ml
  • Form Buffer
    Glucagon antibody is Provided as lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCG antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB
  • Usage Recommendations
    WB: 1 ug/ml
  • Assay Information
    Glucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody
  • Additional Information
    This is a rabbit polyclonal antibody against GCG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
  • URL
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Description
    Glucagon gene and the glucagon like peptide or GLP1 gene are peptide hormones, produced by alpha cells of the pancreas to raise the concentration of glucose in the blood as opposite of insulin, which lowers the glucose. Anti human glucagon and glp1 antibodies are used to study diabetes.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    GLP2R, GCG, GCGR
  • Short name
    Glucagon antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Rabbit polyclonal Glucagon antibody raised against the middle region of GCG
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    glucagon like peptide 2 receptor
  • Synonyms gene name
    • glucagon-like peptide 2 receptor
  • GenBank acession
  • Locus
  • Discovery year
    1999-02-23
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Glucagon receptor family
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee