Glucagon antibody
-
Catalog number70R-6207
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchNutrition & Metabolism
-
Type of ImmunogenGlucagon antibodies were raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN
-
Raised inRabbit
-
SpecificityGlucagon antibody was raised against the middle region of GCG
-
Cross ReactivityHuman,Mouse,Rat
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferGlucagon antibody is Provided as lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCG antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationGlucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody
-
Additional InformationThis is a rabbit polyclonal antibody against GCG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
DescriptionGlucagon gene and the glucagon like peptide or GLP1 gene are peptide hormones, produced by alpha cells of the pancreas to raise the concentration of glucose in the blood as opposite of insulin, which lowers the glucose. Anti human glucagon and glp1 antibodies are used to study diabetes.
-
French translationanticorps
-
Gene target
-
Gene symbolGLP2R, GCG, GCGR
-
Short nameGlucagon antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal Glucagon antibody raised against the middle region of GCG
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameglucagon like peptide 2 receptor
-
Synonyms gene name
- glucagon-like peptide 2 receptor
-
GenBank acession
-
Locus
-
Discovery year1999-02-23
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Glucagon receptor family
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameglucagon
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Receptor ligands
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameglucagon receptor
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-03-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Glucagon receptor family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data