Eph Receptor A5 antibody
-
Catalog number70R-2219
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchSignal Transduction
-
Type of ImmunogenEph Receptor A5 antibodies were raised using the middle region of EPHA5 corresponding to a region with amino acids SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
-
Raised inRabbit
-
SpecificityEph Receptor A5 antibody was raised against the middle region of EPHA5
-
Cross ReactivityHuman,Mouse,Rat
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPHA5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationEph Receptor A5 Blocking Peptide, catalog no. 33R-8364, is also available for use as a blocking control in assays to test for specificity of this Eph Receptor A5 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against EPHA5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
DescriptionThe receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translationanticorps
-
Gene target
-
Gene symbolEFNA5, EPHA5
-
Short nameEph Receptor A5 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal Eph Receptor A5 antibody raised against the middle region of EPHA5
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameephrin A5
-
Synonyms gene
-
Synonyms gene name
- ephrin-A5
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-05-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ephrins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameEPH receptor A5
-
Synonyms gene name
- EphA5
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-10-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- EPH receptors
- Sterile alpha motif domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data