-
Category
Proteins
-
Antibody Subtype
Blocking Peptides
-
Area of research
Proteases, Inhibitors, & Enzymes
-
Residues
FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR
-
Type of protein
Synthetic
-
Form Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
-
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
-
Shipping conditions
Blue Ice
-
Tested for
WB; IHC
-
-
-
Test
You can block the antibody by the specific target amino acid sequence of peptide.
-
Properties
blocking peptide
-
Description
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
-
Gene target
-
Gene symbol
DHODH
-
Short name
DHODH Blocking Peptide
-
Technique
blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
-
Alternative name
A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-1749
-
Alternative technique
control, peptides
-
Alternative to gene target
dihydroorotate dehydrogenase (quinone), DHOdehase and POADS and URA1, DHODH and IDBG-41409 and ENSG00000102967 and 1723, ubiquinone binding, Plasma membranes, Dhodh and IDBG-191275 and ENSMUSG00000031730 and 56749, DHODH and IDBG-634716 and ENSBTAG00000046908 and
-