ApoBEC2 antibody

• Catalog number
  70R-1425
• Price
  Please ask
• Size
  100 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  ApoBEC2 antibodies were raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
• Raised in
  Rabbit
• Specificity
  ApoBEC2 antibody was raised against the N terminal of APOBEC2
• Cross Reactivity
  Human,Dog
• Method of Purification
  Total IgG Protein A purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of APOBEC2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• Usage Recommendations
  WB: 1.25 ug/ml; IHC: 4-8 ug/ml
• Assay Information
  ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against APOBEC2. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ApoBEC2  
• Gene symbol
  APOBEC2
• Short name
  ApoBEC2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ApoBEC2 antibody raised against the N terminal of APOBEC2
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:605
• Gene
  APOBEC2
• Long gene name
  apolipoprotein B mRNA editing enzyme catalytic subunit 2
• Synonyms gene name
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
• Synonyms
  • ARCD1
  • ARP1
• GenBank acession
  • AF161698
• Locus
  6p21.1
• Discovery year
  1999-08-12
• Entrez gene record
  10930
• Pubmed identfication
  • 10403781
• RefSeq identity
  • NM_006789
• Classification
  • Apolipoprotein B mRNA editing enzyme catalytic subunits
• VEGA ID
  OTTHUMG00000014670

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products