- Catalog number70R-1425
- Product nameRabbit ApoBEC2 antibody
- Size100 ug
- PriceAsk For Price
- ApplicationsWB, IHC
- Product TypePrimary Antibodies
- Product SubtypePurified Polyclonal Antibodies
- Research AreaCell Biology
- ImmunogenApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
- HostRabbit, Rabbits
- SpecificityApoBEC2 antibody was raised against the N terminal of APOBEC2
- Cross ReactivityHuman,Dog
- IsotypeNA
- CloneNA
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of APOBEC2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Gene targetApoBEC2
- Identity:HGNC:605
- Gene:APOBEC2
- Long gene name:apolipoprotein B mRNA editing enzyme catalytic subunit 2
- Synonyms gene name:apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
- Synonyms:ARCD1ARP1
- Discovery year:1999-08-12
- Entrez gene record:10930
- Pubmed identification:10403781
- RefSeq identity:NM_006789
- Classification:Apolipoprotein B mRNA editing enzyme catalytic subunits
- VEGA ID:OTTHUMG00000014670
- Gene symbolAPOBEC2
- isotype filter
- NA
- Short nameRabbit ApoBEC2 antibody
- technique filter
- Antibody
- Rabbit
- TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies, rabbit-anti