Mouse anti Integrin alpha 3B + alpha 6B, Primary Antibodies

  • Catalog number
    MUB0903P
  • Price
    Please ask
  • Size
    0,1mg
  • Host Source
    Mouse
  • Clone Name
    PB36
  • Product Category
    Cancer,Cell adhesion
  • Species Reactivity
    Human
  • Application
    Immunocytochemistry,Immunohistochemistry (frozen),Western blotting
  • Immunogen
    PB36 is a Mouse monoclonal IgG1, _ antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin _3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
  • Purification Method
    NA
  • Shipping Conditions
    NA
  • Storage conditions
    Mouse anti Integrin alpha 3B + alpha 6B, Primary Antibodies t 4ÁC, or in small aliquots at -20ÁC.
  • Datasheet link
    NA
  • Description
    The Mouse anti Integrin alpha 3B + alpha 6B, Primary Antibodies is a α- or alpha protein sometimes glycoprotein present in blood. This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Gene target
  • Short name
    Mouse anti Integrin alpha 3B + alpha 6B, Primary Antibodies
  • Technique
    Mouse, anti, antibody to, mouses
  • Host
    mouse
  • Isotype
    IgG1
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse antibody to Integrin a 3B + a 6B, captor Antibodies
  • Alternative technique
    murine, antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee