PC4 Antibody
-
Catalog numberPB10098
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenPC4
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, rat
-
AnalysesWB,IHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the PC4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe PC4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundActivated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.
-
Related articles1. "Entrez Gene SUB1: SUB1 homolog (S. cerevisiae)". 2. Kretzschmar M, Kaiser K, Lottspeich F, Meisterernst M (August 1994). "A novel mediator of class II gene transcription with homology to viral immediate-early transcriptional regulators". Cell 78 (3): 525–34. 3. Ge H, Roeder RG (August 1994). "Purification, cloning, and characterization of a human coactivator, PC4, that mediates transcriptional activation of class II genes". Cell 78 (3): 513–23.
-
Gene NameSUB1
-
Protein NameActivated RNA polymerase II transcriptional coactivator p15
-
Gene Full NameSUB1 homolog, transcriptional regulator
-
Synonymsp14 | P15 | PC4 | PC4 LSB | Positive cofactor 4 | RPO2TC1 | Sub1 | P53999
-
Uniprot IDP53999
-
Entrez GeneID10923
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolIFRD1, SUB1, PCSK4
-
Short namePC4 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative namePC4 (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterferon related developmental regulator 1
-
Synonyms gene name
- interferon-related developmental regulator 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-01-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Armadillo like helical domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameSUB1 regulator of transcription
-
Synonyms gene name
- SUB1 homolog (S. cerevisiae)
- SUB1 homolog, transcriptional regulator
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2005-08-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameproprotein convertase subtilisin/kexin type 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-10-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Proprotein convertase subtilisin/kexin family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data