PC4 Antibody

  • Catalog number
    PB10098
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    PC4
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, rat
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL), different from the related mouse and rat sequences by one amino acid.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the PC4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The PC4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Activated RNA polymerase II transcriptional coactivator p15, also known as positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.
  • Related articles
    1. "Entrez Gene SUB1: SUB1 homolog (S. cerevisiae)". 2. Kretzschmar M, Kaiser K, Lottspeich F, Meisterernst M (August 1994). "A novel mediator of class II gene transcription with homology to viral immediate-early transcriptional regulators". Cell 78 (3): 525–34. 3. Ge H, Roeder RG (August 1994). "Purification, cloning, and characterization of a human coactivator, PC4, that mediates transcriptional activation of class II genes". Cell 78 (3): 513–23.
  • Gene Name
    SUB1
  • Protein Name
    Activated RNA polymerase II transcriptional coactivator p15
  • Gene Full Name
    SUB1 homolog, transcriptional regulator
  • Synonyms
    p14 | P15 | PC4 | PC4 LSB | Positive cofactor 4 | RPO2TC1 | Sub1 | P53999
  • Uniprot ID
    P53999
  • Entrez GeneID
    10923
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    PC4  
  • Gene symbol
    IFRD1, SUB1, PCSK4
  • Short name
    PC4 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    PC4 (antibody to-)
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    interferon related developmental regulator 1
  • Synonyms gene name
    • interferon-related developmental regulator 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-01-21
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Armadillo like helical domain containing
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee