PC4 Antibody / Positive cofactor 4

  • Catalog number
    R32566
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    PC4 / Positive cofactor 4
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
  • Added buffer
    Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
  • Intented use
    This PC4 antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P53999
  • Purity
    Antigen affinity
  • Description
    Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.
  • Immunogen
    Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody.
  • Storage
    After reconstitution, the PC4 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Nuclear
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Additional description
    Positive controls are the same as the target vector or antibody or protein and can be spiked to the sample before the analysis starts.
  • Group
    positif
  • French translation
    anticorps
  • Gene target
    PC4   cofactor  
  • Gene symbol
    IFRD1, SUB1, PCSK4
  • Short name
    Anti- PC4 / Positive cofactor 4
  • Technique
    Antibody, Positive, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to PC4 / Positive cofactor 4
  • Alternative technique
    controls, antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    interferon related developmental regulator 1
  • Synonyms gene name
    • interferon-related developmental regulator 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-01-21
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Armadillo like helical domain containing
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee