KDM5B Antibody

• Catalog number
  PB10073
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  KDM5B
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the KDM5B Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The KDM5B Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.
• Related articles
  1. Lahoud MH, Ristevski S, Venter DJ, Jermiin LS, Bertoncello I, Zavarsek S, Hasthorpe S, Drago J, de Kretser D, Hertzog PJ, Kola I (August 2001). "Gene targeting of Desrt, a novel ARID class DNA-binding protein, causes growth retardation and abnormal development of reproductive organs". Genome Research 11(8): 1327–34. 2. Zhu L, Hu J, Lin D, Whitson R, Itakura K, Chen Y (August 2001). "Dynamics of the Mrf-2 DNA-binding domain free and in complex with DNA". Biochemistry 40 (31): 9142–50.
• Gene Name
  KDM5B
• Protein Name
  Lysine-specific demethylase 5B
• Gene Full Name
  lysine demethylase 5B
• Synonyms
  CT31 | JARID1B | Kdm5b | PLU-1 | PLU1 | PPP1R98 | PUT1 | RBBP2H1A | RBP2-H1 | Q9UGL1
• Uniprot ID
  Q9UGL1
• Entrez GeneID
  10765
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  KDM5B  
• Gene symbol
  KDM5B, PCAT6
• Short name
  KDM5B Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  KDM5B (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:18039
• Gene
  KDM5B
• Long gene name
  lysine demethylase 5B
• Synonyms gene
  • JARID1B
• Synonyms gene name
  • Jumonji, AT rich interactive domain 1B (RBP2-like)
  • jumonji, AT rich interactive domain 1B
  • lysine (K)-specific demethylase 5B
• Synonyms
  • RBBP2H1A
  • PLU-1
  • CT31
  • PPP1R98
• Synonyms name
  • cancer/testis antigen 31
  • protein phosphatase 1, regulatory subunit 98
• GenBank acession
  • AJ243706
• Locus
  1q32.1
• Discovery year
  2004-01-28
• Entrez gene record
  10765
• Pubmed identfication
  • 11483573
  • 11478881
• RefSeq identity
  • NM_006618
• Classification
  • PHD finger proteins
  • Lysine demethylases
  • AT-rich interaction domain containing
• VEGA ID
  OTTHUMG00000041401

Gene info

• Identity
  HGNC:43714
• Gene
  PCAT6
• Long gene name
  prostate cancer associated transcript 6
• Synonyms gene
  • KDM5B-AS1
• Synonyms gene name
  • KDM5B antisense RNA 1 (head to head)
  • prostate cancer associated transcript 6 (non-protein coding)
• Synonyms
  • ncRNA-a2
  • PCAN-R1
  • KDM5BAS1
  • onco-lncRNA-96
• Synonyms name
  • prostate cancer-associated noncoding RNA 1
• GenBank acession
  • BI962506
  • AI806248
• Locus
  1q32.1
• Discovery year
  2012-02-02
• Entrez gene record
  100506696
• Pubmed identfication
  • 20887892
  • 23728290
• RefSeq identity
  • NR_046325
• Classification
  • Long non-coding RNAs with non-systematic symbols
• VEGA ID
  OTTHUMG00000041399

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products