ATP7b Antibody
-
Catalog numberA00686
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenATP7b
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB,IHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human ATP7b (616-652aa RDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the ATP7b Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe ATP7b Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundATPase, Cu++ transporting, beta polypeptide (Wilson disease) protein, also called ATP7B, is an ATPase that transports copper. This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least two putative copper-binding sites. ATP7B is mapped to 13q14.3. This protein functions as a monomer, exporting copper out of the cells. When copper levels are in excess, ATP7B redistributes to a vesicular compartment near the biliary canalicular membranes for elimination of excess copper into bile, and it is transported along liver cell microtubules via interaction with the p62 dynactin subunit.
-
Related articles1. "Entrez Gene: ATP7B ATPase, Cu++ transporting, beta polypeptide". 2. Lim, C. M., Cater, M. A., Mercer, J. F. B., La Fontaine, S. Copper-dependent interaction of dynactin subunit p62 with the N terminus of ATP7B but not ATP7A. J. Biol. Chem. 281: 14006-14014, 2006.
-
Gene NameATP7B
-
Protein NameCopper-transporting ATPase 2
-
Gene Full NameATPase, Cu++ transporting, beta polypeptide
-
SynonymsATP7B | Copper pump 2 | Coppertransporting ATPase 2 | Copper-transporting ATPase 2 | P35670 | PWD | WND | WC1 | Wilson disease-associated protein
-
Uniprot IDP35670
-
Entrez GeneID540
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolATP7B
-
Short nameATP7b Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameATP7b (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameATPase copper transporting beta
-
Synonyms gene
-
Synonyms gene name
- ATPase, Cu++ transporting, beta polypeptide (Wilson disease)
- ATPase, Cu++ transporting, beta polypeptide
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ATPase copper transporting
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data