Anti-Caspase-2 Picoband Antibody

  • Catalog number
    PB9368
  • Price
    Please ask
  • Size
    100µg/vial
  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross reactivity
    No cross reactivity with other proteins.
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat
  • Applications
    WB
  • Reactivity
    Human, Mouse, Rat
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=PB9368
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use. Human and some mouse caspases are active in apoptosis and cell death and even in necrosis and inflammation. CASP Gene and orthologous enzymes have been identifies successfully in the signal transduction cascade and pathways.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    Anti-Caspase-2 Picoband Antibody
  • Technique
    Antibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
  • Host
    Rabbit
  • Isotype
    N/A
  • Alternative name
    Antibody toCasp-2 Picoband (antibody to-)
  • Alternative technique
    antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee