MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)

  • Catalog number
    30 100 803
  • Price
    Please ask
  • Size
    200 µg/ 1 ml
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.24.35
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Protein description
    MMP13 plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CTGF. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CTGF. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion
  • Research area interests
    Diseases associated with MMP13 include Spondyloepimetaphyseal Dysplasia, Missouri Type and Metaphyseal Dysplasia, Spahr Type. Among its related pathways are Integrin Pathway and Development_Glucocorticoid receptor signaling.
  • Package form
    liquid
  • Tested applications
    Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Other names
    Matrix Metalloproteinase 13 (Procollagenase 3)
  • Peptide sequence
    MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWCHHHHHH
  • Available target modification
    No
  • Expression system
    Insect Cell
  • Product Subtype
    full length
  • Active form
    Yes, after APMA activation
  • Tag
    His-tagged
  • Contents
    50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
  • Protein purity
    >95%
  • Molecular weight
    60 kDa
  • UniProt number
    P45452
  • Gene number
    4322
  • Abbreviation
    MMP13
  • Full name
    matrix metallopeptidase 13
  • Other desciption
    Human recombinant procollagenase-3 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Conjugation
    histidine
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    MMP24, MMP14, MMP28, MMP17, MMP15, MMP25, MMP16
  • Short name
    MMP 13 (Procollagenase 3), His-tagged (Recombinant Protein)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    his-tagged
  • Species
    Homo sapiens
  • Alternative name
    MMP 13 (Procollagenase 3), histidine-tagged (Rec. Protein)
  • Alternative technique
    rec
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 17
  • Synonyms gene name
    • matrix metalloproteinase 17 (membrane-inserted)
    • matrix metallopeptidase 17 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 16
  • Synonyms gene
  • Synonyms gene name
    • matrix metalloproteinase 16 (membrane-inserted)
    • chromosome 8 open reading frame 57
    • matrix metallopeptidase 16 (membrane-inserted)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-13
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee