Recombinant Salmonella typhimurium Protein prgI(prgI)

  • Catalog number
    RPC20119
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
  • Protein number
    P41784
  • Gene number
    prgI
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    1-80aa
  • Protein sequence
    MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR
  • Information about sequence
    Full Length
  • Expected molecular weight
    24.9kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Salmonella typhimurium Protein prgI(prgI)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Salmonella, Salmonellas
  • Alternative name
    Rec. Salmonella typhimurium Protein prgI(prgI)
  • Alternative technique
    rec
  • Disease
    Salmonella typhimurium, enteriditis and Salmonella paratyphi antibodies or media detect this rod-shaped (bacillus) gram-negative bacteria of the Enterobacteriaceae family. The two species of Salmonella are Salmonella enterica and Salmonella bongori. Salmonella enterica is the type species and is further divided into six subspecies that include over 2500 serovars. S. enterica subspecies are found worldwide in all warm-blooded animals, and in the environment. S. bongori is restricted to cold-blooded animals particularly reptiles. Strains of Salmonella cause illnesses such as typhoid fever, paratyphoid fever, and food poisoning (salmonellosis).
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee