Recombinant Human Fc receptor-like protein 6(FCRL6),partial

• Catalog number
  RPC20296
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  Q6DN72
• Gene number
  FCRL6
• Other name
  Fc receptor homolog 6
• Protein origin
  E.coli
• Protein region
  20-307aa
• Protein sequence
  LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
• Information about sequence
  Extracellular Domain
• Expected molecular weight
  35.8kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  receptor-like   protein   FCRL6   partial  
• Gene symbol
  FCRL6
• Short name
  Recombinant Fc receptor-like protein 6(FCRL6),partial
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-tagged
• Species
  Human, Humans
• Alternative name
  Rec. H. sapiens fragment c receptor-like protein 6(fragment c receptor-like 6),partial
• Alternative technique
  rec
• Alternative to gene target
  Fc receptor-like 6, FCRL6 and IDBG-103929 and ENSG00000181036 and 343413, protein phosphatase binding, Cell surfaces, Fcrl6 and IDBG-205647 and ENSMUSG00000070504 and 677296, FCRL6 and IDBG-630741 and ENSBTAG00000017786 and 524565

Gene info

• Identity
  HGNC:31910
• Gene
  FCRL6
• Long gene name
  Fc receptor like 6
• Synonyms gene name
  • Fc receptor-like 6
• Synonyms
  • IFGP6
  • FLJ16056
  • FcRH6
• GenBank acession
  • AK131201
• Locus
  1q23.2
• Discovery year
  2005-03-31
• Entrez gene record
  343413
• RefSeq identity
  • NM_001004310
• Classification
  • Immunoglobulin like domain containing
• VEGA ID
  OTTHUMG00000035351

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products