Rabbit FCRL6 antibody

#
  • Catalog number
    70R-6657
  • Price:

    Please ask

    Ask for price
  • Size
    50 ug
# #
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Immunology
  • Immunogen
    FCRL6 antibody was raised using the middle region of FCRL6 corresponding to a region with amino acids LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ
  • Specificity
    FCRL6 antibody was raised against the middle region of FCRL6
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCRL6 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
#
  • Gene target
    FCRL6  
  • Gene symbol
    FCRL6
  • Short name
    Rabbit FCRL6 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal FCRL6 antibody raised against the middle region of FCRL6
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    Fc receptor-like 6, FCRL6 and IDBG-103929 and ENSG00000181036 and 343413, protein phosphatase binding, Cell surfaces, Fcrl6 and IDBG-205647 and ENSMUSG00000070504 and 677296, FCRL6 and IDBG-630741 and ENSBTAG00000017786 and 524565
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee