Rabbit FCRL6 antibody
-
Catalog number70R-6657
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenFCRL6 antibody was raised using the middle region of FCRL6 corresponding to a region with amino acids LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ
-
SpecificityFCRL6 antibody was raised against the middle region of FCRL6
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCRL6 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFCRL6
-
Short nameRabbit FCRL6 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FCRL6 antibody raised against the middle region of FCRL6
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFc receptor-like 6, FCRL6 and IDBG-103929 and ENSG00000181036 and 343413, protein phosphatase binding, Cell surfaces, Fcrl6 and IDBG-205647 and ENSMUSG00000070504 and 677296, FCRL6 and IDBG-630741 and ENSBTAG00000017786 and 524565
-
Gene info
-
Identity
-
Gene
-
Long gene nameFc receptor like 6
-
Synonyms gene name
- Fc receptor-like 6
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-03-31
-
Entrez gene record
-
RefSeq identity
-
Classification
- Immunoglobulin like domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data