Recombinant Human Early Activation Antigen CD69/CD69 (N-8His)

• Catalog number
  CU12-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Early Activation Antigen CD69 is produced by our Mammalian expression system and the target gene encoding Gly64-Lys199 is expressed with a 8His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  HHHHHHHHGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
• Estimated molecular weight
  16.9
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q07108
• Other related products
• Additional description
  Antigens are peptides or recombinant or native dependent on the production method.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Early   Activation   CD69/CD69   N-8His  
• Gene symbol
  CD69
• Short name
  Recombinant Early Activation Antigen CD69/CD69 (N-8His)
• Technique
  Recombinant, activation, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human CD69 (N-8His)
• Alternative technique
  rec, antigenes
• Alternative to gene target
  CD69 molecule, AIM and BL-AC/P26 and CLEC2C and EA1 and GP32/28 and MLR-3, CD69 and IDBG-18077 and ENSG00000110848 and 969, carbohydrate binding, Cell surfaces, Cd69 and IDBG-191849 and ENSMUSG00000030156 and 12515, CD69 and IDBG-639618 and ENSBTAG00000002135 and 281058

Gene info

• Identity
  HGNC:1694
• Gene
  CD69
• Long gene name
  CD69 molecule
• Synonyms gene name
  • CD69 antigen (p60, early T-cell activation antigen)
• Synonyms
  • CLEC2C
• GenBank acession
  • Z22576
• Locus
  12p13.31
• Discovery year
  1992-08-06
• Entrez gene record
  969
• Pubmed identfication
  • 1612643
• Classification
  • C-type lectin domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000168481

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products