Recombinant Human Early Activation Antigen CD69/CD69 (N-8His)

  • Catalog number
    CU12-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human Early Activation Antigen CD69 is produced by our Mammalian expression system and the target gene encoding Gly64-Lys199 is expressed with a 8His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    HHHHHHHHGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
  • Estimated molecular weight
    16.9
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q07108
  • Additional description
    Antigens are peptides or recombinant or native dependent on the production method.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CD69
  • Short name
    Recombinant Early Activation Antigen CD69/CD69 (N-8His)
  • Technique
    Recombinant, activation, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human CD69 (N-8His)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    CD69 molecule, AIM and BL-AC/P26 and CLEC2C and EA1 and GP32/28 and MLR-3, CD69 and IDBG-18077 and ENSG00000110848 and 969, carbohydrate binding, Cell surfaces, Cd69 and IDBG-191849 and ENSMUSG00000030156 and 12515, CD69 and IDBG-639618 and ENSBTAG00000002135 and 281058
Gene info
  • Identity
  • Gene
  • Long gene name
    CD69 molecule
  • Synonyms gene name
    • CD69 antigen (p60, early T-cell activation antigen)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1992-08-06
  • Entrez gene record
    969
  • Pubmed identfication
  • Classification
    • C-type lectin domain containing
    • CD molecules
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee