200ug-Anti-Enolase, Neuron Specific (NSE)-polyclonal Antibody

  • Catalog number
    PAA537Hu02-200ug
  • Price
    Please ask
  • Size
    200ug
  • Organism Species
    Homo sapiens (Human)
  • Source
    Polyclonal antibody preparation
  • Purification
    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Buffer Formulation
    0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
  • Item Name
    Enolase, Neuron Specific
  • Immunogen
    RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
  • Image number
    4
  • Species reactivity
    Human,Mouse
  • Sequence of immunogen
    NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Aplication
    WB,IHC
  • Clonality
    Rabbit-polyclonal
  • Concentration
    500ug/ml
  • Alternative Names
    ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
  • Applicable Secondary Antibody
    SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19
  • Manual link
    -
  • Delivery condition
    4℃ with ice bags
  • Storage instructions
    Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
  • Properties
    If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Group
    Polyclonals and antibodies
  • About
    Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
  • French translation
    anticorps
  • Gene target
    200ug   Enolase   Neuron   Specific   NSE  
  • Short name
    200ug-Anti-Enolase, Neuron Specific (NSE)-polyclonal Antibody
  • Technique
    Polyclonal, Antibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
  • Host
    Rabbit
  • Alternative name
    200ug-Antibody toEnolase, Neuron Specific (NSE)-polyclonal (antibody to-)
  • Alternative technique
    polyclonals, antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee