DNAJB6 antibody

• Catalog number
  70R-2575
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Protein Modification & Stress Response
• Type of Immunogen
  DNAJB6 antibodies were raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS
• Raised in
  Rabbit
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJB6 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  DNAJB6 Blocking Peptide, catalog no. 33R-7052, is also available for use as a blocking control in assays to test for specificity of this DNAJB6 antibody
• Additional Information
  This is a rabbit polyclonal antibody against DNAJB6, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  DNAJB6  
• Gene symbol
  DNAJB6
• Short name
  DNAJB6 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal DNAJB6 antibody
• Alternative technique
  antibodies
• Alternative to gene target
  DnaJ (Hsp40) homolog, subfamily B, member 6, DJ4 and DnaJ and HHDJ1 and HSJ-2 and HSJ2 and LGMD1D and LGMD1E and MRJ and MSJ-1, DNAJB6 and IDBG-50846 and ENSG00000105993 and 10049,102724007, chaperone binding, nuclei, Dnajb3 and IDBG-394183 and ENSMUSG00000081984 and 15504, LOC528549 and IDBG-648942 and ENSBTAG00000018756 and 528549

Gene info

• Identity
  HGNC:14888
• Gene
  DNAJB6
• Long gene name
  DnaJ heat shock protein family (Hsp40) member B6
• Synonyms gene
  • LGMD1D
• Synonyms gene name
  • limb girdle muscular dystrophy 1D (autosomal dominant)
  • DnaJ (Hsp40) homolog, subfamily B, member 6
• Synonyms
  • MRJ
• GenBank acession
  • AB014888
• Locus
  7q36.3
• Discovery year
  2001-03-09
• Entrez gene record
  10049
• Pubmed identfication
  • 10319584
  • 9915854
  • 22366786
• RefSeq identity
  • NM_058246
• Classification
  • DNAJ (HSP40) heat shock proteins
• VEGA ID
  OTTHUMG00000157242

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products