Rabbit DNAJB6 antibody
-
Catalog number70R-2575
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenDNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJB6 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDNAJB6
-
Short nameRabbit DNAJB6 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DNAJB6 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetDnaJ (Hsp40) homolog, subfamily B, member 6, DJ4 and DnaJ and HHDJ1 and HSJ-2 and HSJ2 and LGMD1D and LGMD1E and MRJ and MSJ-1, DNAJB6 and IDBG-50846 and ENSG00000105993 and 10049,102724007, chaperone binding, nuclei, Dnajb3 and IDBG-394183 and ENSMUSG00000081984 and 15504, LOC528549 and IDBG-648942 and ENSBTAG00000018756 and 528549
-
Gene info
-
Identity
-
Gene
-
Long gene nameDnaJ heat shock protein family (Hsp40) member B6
-
Synonyms gene
-
Synonyms gene name
- limb girdle muscular dystrophy 1D (autosomal dominant)
- DnaJ (Hsp40) homolog, subfamily B, member 6
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-03-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- DNAJ (HSP40) heat shock proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data