Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), PE

  • Catalog number
    PAA537Hu02-20ul-PE
  • Price
    Please ask
  • Size
    20ul
  • Description
    A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE.
  • Specifications
    Host: Rabbit; Species Reactivity: Human, Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: PE
  • Additional_information
    Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT); Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
  • Storage_and_shipping
    Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
  • Notes
    Research Use Only.
  • Properties
    If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Group
    Polyclonals and antibodies
  • About
    Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
  • French translation
    anticorps
  • Gene target
    Enolase   Neuron   Specific   NSE  
  • Short name
    Enolase, Neuron Specific (NSE) Polyclonal Antibody ( , Mouse), PE
  • Technique
    Polyclonal, Antibody, Mouse, antibodies against human proteins, antibodies for, mouses, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
  • Host
    mouse
  • Label
    PE
  • Species
    Mouse, Humans, Mouses
  • Alternative name
    Enolase, Neuron Specific (NSE) polyclonal (antibody to-) (H. sapiens, Mouse), peroxidase
  • Alternative technique
    polyclonals, antibodies, murine
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee