100ug-Anti- Enolase, Neuron Specific (NSE)

  • Catalog number
    MAA537Hu22-100ug
  • Price
    Please ask
  • Size
    100ug
  • Organism Species
    Homo sapiens (Human)
  • Source
    Monoclonal antibody preparation
  • Purification
    Protein A + Protein G affinity chromatography
  • Buffer Formulation
    PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
  • Item Name
    Enolase, Neuron Specific
  • Immunogen
    RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
  • Image number
    6
  • Species reactivity
    Human,Mouse
  • Sequence of immunogen
    Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Aplication
    WB,IHC
  • Clonality
    Mouse monoclonal
  • Concentration
    1mg/ml
  • Alternative Names
    ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
  • Applicable Secondary Antibody
    SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17
  • Delivery condition
    4℃ with ice bags
  • Storage instructions
    Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Gene target
    100ug   Enolase   Neuron   Specific   NSE  
  • Short name
    100ug-Anti- Enolase, Neuron Specific (NSE)
  • Technique
    anti, antibody to
  • Host
    Mouse
  • Alternative name
    100ug-antibody to- Enolase, Neuron Specific (NSE)
  • Alternative technique
    antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee