Mouse, Anti- Enolase, Neuron Specific (NSE)-Monoclonal antibody

  • Catalog number
    MAA537Hu22-1mg
  • Price
    Please ask
  • Size
    1mg
  • Organism Species
    Homo sapiens (Human)
  • Source
    Monoclonal antibody preparation
  • Purification
    Protein A + Protein G affinity chromatography
  • Buffer Formulation
    PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
  • Item Name
    Enolase, Neuron Specific
  • Immunogen
    RPA537Hu02-Recombinant Enolase, Neuron Specific (NSE)
  • Image number
    6
  • Species reactivity
    Human,Mouse
  • Sequence of immunogen
    Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Aplication
    WB,IHC
  • Clonality
    Mouse monoclonal
  • Concentration
    1mg/ml
  • Alternative Names
    ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
  • Applicable Secondary Antibody
    SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17
  • Delivery condition
    4℃ with ice bags
  • Storage instructions
    Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20℃ for 12 months.
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Properties
    If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • French translation
    anticorps
  • Gene target
  • Short name
    Mouse, Anti- Enolase, Neuron Specific (NSE)-Monoclonal antibody
  • Technique
    Antibody, Mouse, anti, antibody to, antibodies against human proteins, antibodies for, Monoclonals or monoclonal antibodies, mouses
  • Host
    Mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse, antibody to- Enolase, Neuron Specific (NSE)-monoclonal (antibody to-)
  • Alternative technique
    antibodies, murine
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee