Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), FITC
-
Catalog number
PAA537Hu02-200ul-FITC
-
Price
Please ask
-
Size
200ul
-
-
Description
A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.
-
Specifications
Host: Rabbit; Species Reactivity: Human, Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: FITC
-
Additional_information
Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT); Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
-
Storage_and_shipping
Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
-
Notes
Research Use Only.
-
Properties
If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. This Cloud Clone Corp Fluorescein isothiocyanate (FITC) antibody is currently after some BD antibodies the most commonly used fluorescent dye for FACS. When excited at 488 nanometers, FITC has a green emission that's usually collected at 530 nanometers, the FL1 detector of a FACSCalibur or FACScan. FITC has a high quantum yield (efficiency of energy transfer from absorption to emission fluorescence) and approximately half of the absorbed photons are emitted as fluorescent light. For fluorescent microscopy applications, the 1 FITC is seldom used as it photo bleaches rather quickly though in flow cytometry applications, its photo bleaching effects are not observed due to a very brief interaction at the laser intercept. Cloud Clone Corp FITC is highly sensitive to pH extremes. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Conjugation
Anti-FITC Antibody
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
-
Group
Polyclonals and antibodies
-
About
Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
-
French translation
anticorps
-
Gene target
-
Short name
Enolase, Neuron Specific (NSE) Polyclonal Antibody ( , Mouse), FITC
-
Technique
Polyclonal, Antibody, Mouse, FITC, antibodies against human proteins, antibodies for, Fluorescein, mouses, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
-
Host
mouse
-
Label
FITC
-
Species
Mouse, Humans, Mouses
-
Alternative name
Enolase, Neuron Specific (NSE) polyclonal (antibody to-) (H. sapiens, Mouse), fluorecein
-
Alternative technique
polyclonals, antibodies, murine, fluorescine
-
MeSH Data
-
Name
-
Concept
Scope note:
A method for the study of certain organic compounds within cells, in situ, by measuring the light intensities of the selectively stained areas of cytoplasm. The compounds studied and their locations in the cells are made to fluoresce and are observed under a microscope.
-
Tree numbers
- E01.370.225.500.386
- E05.196.712.516.600.240
- E05.200.500.386
- E05.242.386
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products