Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), FITC

  • Catalog number
    PAA537Hu02-20ul-FITC
  • Price
    Please ask
  • Size
    20ul
  • Description
    A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.
  • Specifications
    Host: Rabbit; Species Reactivity: Human, Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: FITC
  • Additional_information
    Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT); Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
  • Storage_and_shipping
    Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
  • Notes
    Research Use Only.
  • Properties
    If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. This Cloud Clone Corp Fluorescein isothiocyanate (FITC) antibody is currently after some BD antibodies the most commonly used fluorescent dye for FACS. When excited at 488 nanometers, FITC has a green emission that's usually collected at 530 nanometers, the FL1 detector of a FACSCalibur or FACScan. FITC has a high quantum yield (efficiency of energy transfer from absorption to emission fluorescence) and approximately half of the absorbed photons are emitted as fluorescent light. For fluorescent microscopy applications, the 1 FITC is seldom used as it photo bleaches rather quickly though in flow cytometry applications, its photo bleaching effects are not observed due to a very brief interaction at the laser intercept. Cloud Clone Corp FITC is highly sensitive to pH extremes. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Conjugation
    Anti-FITC Antibody
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Group
    Polyclonals and antibodies
  • About
    Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
  • French translation
    anticorps
  • Gene target
    Enolase   Neuron   Specific   NSE  
  • Short name
    Enolase, Neuron Specific (NSE) Polyclonal Antibody ( , Mouse), FITC
  • Technique
    Polyclonal, Antibody, Mouse, FITC, antibodies against human proteins, antibodies for, Fluorescein, mouses, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
  • Host
    mouse
  • Label
    FITC
  • Species
    Mouse, Humans, Mouses
  • Alternative name
    Enolase, Neuron Specific (NSE) polyclonal (antibody to-) (H. sapiens, Mouse), fluorecein
  • Alternative technique
    polyclonals, antibodies, murine, fluorescine
MeSH Data
  • Name
  • Concept
    Scope note: Test for tissue antigen using either a direct method, by conjugation of antibody with fluorescent dye (FLUORESCENT ANTIBODY TECHNIQUE, DIRECT) or an indirect method, by formation of antigen-antibody complex which is then labeled with fluorescein-conjugated anti-immunoglobulin antibody (FLUORESCENT ANTIBODY TECHNIQUE, INDIRECT). The tissue is then examined by fluorescence microscopy.
  • Tree numbers
    • E01.370.225.500.607.512.240
    • E01.370.225.750.551.512.240
    • E05.200.500.607.512.240
    • E05.200.750.551.512.240
    • E05.478.583.375
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee